RecipeRoulette

Banana-Oat Blender Pancakes

Three pantry staples walk into a blender; pancakes walk out.

🍽️ American ⏱️ 5 min prep · 15 min cook 👥 Serves 2 📊 Beginner
Adapt this to your ingredients →

Ingredients

Method

  1. Blend everything except the butter until smooth, about 30 seconds. Rest the batter 5 minutes — the oats drink up liquid and the baking powder wakes up. Skipping the rest is the number-one flat-pancake crime.
  2. Heat a nonstick pan over medium and melt a little butter until it foams.
  3. Pour ¼-cup rounds and cook until bubbles pierce the surface and the edges look set, 2–3 minutes. These are more delicate than flour pancakes — flip with commitment, not hesitation.
  4. Cook 1–2 minutes more until golden and springy in the center.
  5. Stack, butter, syrup, berries. The bananas did the sweetening; the syrup is just showing off.

quickcheapvegetariankid-friendly

Cooking a protein? Check safe internal temperatures in our food safety guide before serving.